Nur Bild anzeigenTurkey. Ganymede. Divine hero in Greek mythology. Roman relief of the Rape of Ganymede by Zeus’s eagle. Aphrodisias. Turkey.BildnummerAKG1597790KollektionAlbumBildnachweisakg-images / Album / PrismaBilddatum10.12.2010ThemenADLERGOTTKIDNAPPINGLANDWIRTSCHAFTMYTHOLOGIEROMANTIERVOGELPersonenJUPITER (ZEUS)TechnikFOTOGRAFIERELIEFGröße5426px × 3781px (58 MB) 45.9 cm × 32.0 cm @ 300 dpiRestriktionenFor editorial use onlyRights to be cleared for artworks not in public domain. No model release.Zur Lightbox 'My First Lightbox' hinzufügen Zum Warenkorb hinzufügenDownload
